PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0045s0122.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 206aa    MW: 22339.1 Da    PI: 9.2051
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0045s0122.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18132165134
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                          C +Cg+ kTp+WR gpdg+ktLCnaCG++y++ +
  Kaladp0045s0122.1.p 132 CKHCGSEKTPQWRAGPDGPKTLCNACGVRYKSGR 165
                          *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.4E-15126176IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.793126162IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-14129189No hitNo description
Gene3DG3DSA:3.30.50.103.0E-14130163IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.43E-13131179No hitNo description
PfamPF003202.1E-16132166IPR000679Zinc finger, GATA-type
PROSITE patternPS003440132157IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
ESEEEEELEW LSNKDVFPSV ETFVDVIPVE PSTAVLKHVS PVSVLENSIS SFGSNSSNDS  60
NAVITTCCIG RGLTPPIRRP RSRGSQKRRR GGFVDISSQQ WFIYCSSIHA NKTGNNAAKA  120
LGTASGITSR KCKHCGSEKT PQWRAGPDGP KTLCNACGVR YKSGRLCPEY RPASSPTFSS  180
AVHSNSHRKI VEMKKMKQHD GQPCG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285624.11e-55PREDICTED: GATA transcription factor 1 isoform X2
RefseqXP_010650215.11e-55PREDICTED: GATA transcription factor 1 isoform X1
SwissprotQ8LAU96e-53GATA1_ARATH; GATA transcription factor 1
TrEMBLB9RWP41e-56B9RWP4_RICCO; GATA transcription factor, putative
STRINGVIT_05s0051g00450.t013e-55(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-46GATA transcription factor 1